PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E00950.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 149aa    MW: 16315.3 Da    PI: 7.6722
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E00950.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB130.74.8e-4155145292
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                       r+ d+++Pian++r m++vlP++a+i++dake +qec+sefisf+t+ea+ +c+++ r+t++++d+l a+a+lGf++y+epl+v+l+++r 
  Migut.E00950.1.p  55 RDADQYMPIANITRTMRRVLPTHARIADDAKEAIQECISEFISFITAEANRRCHNDYRRTVTPEDVLAAMASLGFNNYLEPLTVFLTNHRA 145
                       789************************************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-3950147IPR009072Histone-fold
SuperFamilySSF471134.81E-3158145IPR009072Histone-fold
PfamPF008083.7E-2160124IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.3E-1388106No hitNo description
PRINTSPR006154.3E-13107125No hitNo description
PRINTSPR006154.3E-13126144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MERGGSSNIG HKYTRRAHTG TDPAVAGPNA ANIVAAPPNA AAGEVNLEHQ QGFKRDADQY  60
MPIANITRTM RRVLPTHARI ADDAKEAIQE CISEFISFIT AEANRRCHND YRRTVTPEDV  120
LAAMASLGFN NYLEPLTVFL TNHRAQNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A8e-3555144493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B8e-3555144493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A8e-3555144392NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839450.16e-92PREDICTED: nuclear transcription factor Y subunit B-9-like
SwissprotQ84W665e-42NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A022QRD84e-68A0A022QRD8_ERYGU; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.1__2386__AT1G21970.18e-40(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-42NF-YB family protein